PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010935925.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 288aa    MW: 32620.4 Da    PI: 5.2099
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010935925.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1661.3e-51101381129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lp+GfrF P+deelv++yL kkv++++++   ++ evd+++ ePw+Lp  +k + +ewyfFs rd+kyatg+r+nratksgyWkatgkd+++++ 
  XP_010935925.1  10 LPRGFRFYPSDEELVCHYLYKKVANERVSG-GTMVEVDLHTREPWELPDVAKLSANEWYFFSFRDRKYATGSRTNRATKSGYWKATGKDRTIYDP 103
                     799************************999.88***************87788999**************************************9 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrle 129
                      +++ vg++ktLvfy+grap+g kt+Wvmhe+rle
  XP_010935925.1 104 tTHAIVGMRKTLVFYRGRAPNGIKTSWVMHEFRLE 138
                     66777***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.09E-608156IPR003441NAC domain
PROSITE profilePS5100558.16210156IPR003441NAC domain
PfamPF023651.6E-2711137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MGLRDIESTL PRGFRFYPSD EELVCHYLYK KVANERVSGG TMVEVDLHTR EPWELPDVAK  60
LSANEWYFFS FRDRKYATGS RTNRATKSGY WKATGKDRTI YDPTTHAIVG MRKTLVFYRG  120
RAPNGIKTSW VMHEFRLENP YTPPKEDWVL CRVFYKMKGD SVNYSLENDQ DNNIGFSSSH  180
LEPSPLNDHP MPDGCDERMG SSFPAVPYQE GNSSNTFLNL ALLHSNCLDF PQEVDGTTMV  240
GVDSGGGDDD FGRLMLDVGM EDHDVVKGAG MANTESMKFH GGNDQLFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-4811564165NO APICAL MERISTEM PROTEIN
1ut4_B8e-4811564165NO APICAL MERISTEM PROTEIN
1ut7_A8e-4811564165NO APICAL MERISTEM PROTEIN
1ut7_B8e-4811564165NO APICAL MERISTEM PROTEIN
3swm_A8e-4811567168NAC domain-containing protein 19
3swm_B8e-4811567168NAC domain-containing protein 19
3swm_C8e-4811567168NAC domain-containing protein 19
3swm_D8e-4811567168NAC domain-containing protein 19
3swp_A8e-4811567168NAC domain-containing protein 19
3swp_B8e-4811567168NAC domain-containing protein 19
3swp_C8e-4811567168NAC domain-containing protein 19
3swp_D8e-4811567168NAC domain-containing protein 19
4dul_A8e-4811564165NAC domain-containing protein 19
4dul_B8e-4811564165NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010935925.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 3-like
SwissprotQ9S8514e-61NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBLM0U5T81e-151M0U5T8_MUSAM; Uncharacterized protein
STRINGGSMUA_AchrUn_randomP02760_0011e-151(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69738166
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.11e-83NAC domain containing protein 74